Antibody Competition
Cat # RDC0692
Cat # FAB5616R
Cat # AF6007G
Cat # AF-480-NAN
Cat # AF7747N
Cat # AF2180U
Cat # AF1546T
Cat # FAB10100S
Cat # FAB701N
Cat # AF6637G
Cat # AF1924X
Cat # AVI10538
Cat # RDC2826
Cat # FAB3257X
Cat # IC9205G
Cat # FAB60072N
Cat # FAB5745N
Cat # FAB36551G
Cat # FAB1205N
Cat # FAB1295T
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human COL20A1
Source: E.coli
Amino Acid Sequence: SLATLYQLVSQACESAIQTHVSKFDSFHENTRPPMPILEQKLEPGTEPLGSPGTRSKALVPGEWGRGGRHLEGRGEPGAVGQMGSPG
Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
>80% by SDS-PAGE and Coomassie blue staining
Antibody Competition (10-100 molar excess)
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-24757It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click admin@frankenthalerfoundation.org.
Recombinant Protein Antigen
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Bio-Techne Denver
Shipping Information
$45 to United States
View Distributors
