Bone growth regulatory peptide

Growth Hormone Releasing Factor (GHRF), mouse

Product Number: 536-10

Description

Growth Hormone Releasing Factor (GHRF, somatocrinin) is a peptide hormone produced in the arcuate nucleus of the hypothalamus. It binds to the GHRH receptor in the anterior pituitary gland and subsequently stimulates growth hormone secretion.

Product Details

Molecular Weight: 5029.72

Salt Form: TFA

Purity: >96%

Sequence (3-letter): His-Val-Asp-Ala-Ile-Phe-Thr-Thr-Asn-Tyr-Arg-Lys-Leu-Leu-Ser-Gln-Leu-Tyr-Ala-Arg-Lys-Val-Ile-Gln-Asp-Ile-Met-Asn-Lys-Gln-Gly-Glu-Arg-Ile-Gln-Glu-Gln-Arg-Ala-Arg-Leu-Ser-OH

Sequence (1-letter): HVDAIFTTNYRKLLSQLYARKVIQDIMNKQGERIQEQRARLS-OH

Storage: -20 °C or below

Additional Information

Related Products

Our high quality products are trusted by many scientists and leading companies.

• Angiotensin (1-5) Product Number: 131-53
• Angiotensin I [Asn1,Val5], goosefish Product Number: 137-39
• Angiotensinogen (1-14) Renin Substrate, porcine Product Number: 131-82
• Atrial Natriuretic Peptide (1-28), human / ANP (1-28), human Product Number: 151-25