Description
Urocortin III (UCN3) decreases food intake and delays gastric emptying activity. UCN3 is a specific ligand for the corticotropin-releasing hormone receptor type 2 (CRHR2), therefore acts as the endogenous ligand for maintaining homeostasis after stress. UCN3 is a 38aa long peptide that corresponds to aa123-160 of the mouse precursor.
Each vial contains 1 mg of lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt.
Urocortin-3; Urocortin III; Ucn III; UCN3
Mouse: H-Phe-Thr-Leu-Ser-Leu-Asp-Val-Pro-Thr-Asn-Ile-Met-Asn-Ile-Leu-Phe-Asn-Ile-Asp-Lys-Ala-Lys-Asn-Leu-Arg-Ala-Lys-Ala-Ala-Ala-Asn-Ala-Gln-Leu-Met-Ala-Gln-Ile-NH2 or H-FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2
C186H312N52O52S2
Purity > 95% by HPLC
Distilled water for a solution up to 2 mg/ml, otherwise we recommend using acetonitrile.
Store at -20°C. The product is hygroscopic and must be protected from light. Product is guaranteed one year from the date of shipment. Following reconstitution, aliquot and store at -20°C.
