Galanin (1-16) supplier

Galanin Lys (Biotin, Human) - FAM Labeled

Catalog Number: B2019488 (1 mg)

Galanin Lys (Biotin, Human) – FAM Labeled is a biotinylated and fluorescently labeled version of the human galanin peptide, used in research to study galanin functions and interactions in biological systems. This product has been used as a molecular tool for various biochemical applications. It has also been used in a wide array of other chemical and immunological applications. Custom bulk amounts of this product are available upon request.

Products are for in vitro research use only (RUO).

Product Details

What's Included

Galanin Lys (Biotin, Human) - FAM Labeled

• Catalog number: B2019488
• Lot number: Batch Dependent
• Expiration Date: Batch dependent
• Amount: 1 mg
• Molecular Weight or Concentration: 3870.2
• Supplied as: Powder
• Applications: a molecular tool for various biochemical applications
• Storage: -20°C
• Keywords: FAM-GWTLNSAGYLLGPHAVGNHRSFSDKNGLTSK(Biotin)
• Grade: Biotechnology grade. All products are highly pure. All solutions are made with Type I ultrapure water (resistivity >18 MΩ-cm) and are filtered through 0.22 um.

References

• Barreto SG, Carati CJ, Schloithe AC, Toouli J, Saccone GT. Galanin potentiates supramaximal caerulein-stimulated pancreatic amylase secretion via its action on somatostatin secretion Am J Physiol Gastrointest Liver Physiol. 2009 Dec;297(6):G1268-73.
• Tatemoto K, Rökaeus A, Jörnvall H, McDonald TJ, Mutt V. Galanin – a novel biologically active peptide from porcine intestine FEBS Lett. 1983 Nov 28;164(1):124-8.
• Anglade I, Wang Y, Jensen J, Tramu G, Kah O, Conlon JM. Characterization of trout galanin and its distribution in trout brain and pituitary J Comp Neurol. 1994 Dec 1;350(1):63-74.
• Bulaj G, Green BR, Lee HK, Robertson CR, White K, Zhang L, Sochanska M, Flynn SP, Scholl EA, Pruess TH, Smith MD, White HS. Design, synthesis, and characterization of high-affinity, systemically-active galanin analogues with potent anticonvulsant activities J Med Chem. 2008 Dec 25;51(24):8038-47.
• Kahl U, Langel U, Bartfai T, Grundemar L. Functional effects and ligand binding of chimeric galanin-neuropeptide Y (NPY) peptides on NPY and galanin receptor types Br J Pharmacol. 1994 Apr;111(4):1129-34.
• Zhang L, Robertson CR, Green BR, Pruess TH, White HS, Bulaj G. Structural requirements for a lipoamino acid in modulating the anticonvulsant activities of systemically active galanin analogues J Med Chem. 2009 Mar 12;52(5):1310-6.
• Schmidt WE, Kratzin H, Eckart K, Drevs D, Mundkowski G, Clemens A, Katsoulis S, Schäfer H, Gallwitz B, Creutzfeldt W. Isolation and primary structure of pituitary human galanin, a 30-residue nonamidated neuropeptide Proc Natl Acad Sci U S A. 1991 Dec 15;88(24):11435-9.
• Zhang L, Klein BD, Metcalf CS, Smith MD, McDougle DR, Lee HK, White HS, Bulaj G. Incorporation of monodisperse oligoethyleneglycol amino acids into anticonvulsant analogues of galanin and neuropeptide y provides peripherally acting analgesics Mol Pharm. 2013 Feb 4;10(2):574-85.
• Ruczyński J, Parfianowicz B, Mucha P, Wiśniewska K, Piechowicz L, Rekowski P. Structure-Activity Relationship of New Chimeric Analogs of Mastoparan from the Wasp Venom Paravespula lewisii Int J Mol Sci. 2022 Jul 27;23(15):8269.

Terms & Conditions

Blue Tiger Scientific is an independent third-party distributor of select products manufactured by Molecular Depot LLC. By purchasing from bluetigerscientific.com, you (“the Customer”) agree to the following terms, adapted from Molecular Depot’s original conditions:

Product Use & Eligibility

Products are for in vitro research use only (RUO). They are not intended for human or animal use, diagnosis, therapy, resale to consumers, or residential delivery. Sales are limited to verified business addresses.

Payment Terms

All purchases are prepaid and non-refundable once confirmed. Pricing is in USD and subject to change without notice.

Purchase Orders

Confirmed orders are final and may not be canceled or refunded unless authorized in writing.

Limitation of Liability

Blue Tiger Scientific and Molecular Depot LLC are not responsible for any damages resulting from product use or misuse.

Waiver of Claims

By ordering, you waive all claims arising from use of Molecular Depot products.

Shipping & Handling

Shipping is calculated at checkout. A minimum 27% handling fee applies to each order.

Delivery Estimates

All delivery timelines are estimates and not guaranteed. FedEx service levels are subject to operational delays, weather disruptions, and regional restrictions.

FedEx Pickup Cutoff

Orders submitted after the daily FedEx pickup window may not ship until the next available pickup day.

Shipping Exceptions

FedEx may impose restrictions or delays due to package size, weight, destination, or service availability. Blue Tiger Scientific is not liable for delays beyond our control.

Weekend & Holiday Handling

Orders placed on weekends or holidays will be processed on the next business day.

Returns & Refunds

Returns must be requested within 30 days through Blue Tiger Scientific. Refunds are only issued for shipping errors or verified defects, and processed within 45 business days if approved. Customers are responsible for return shipping costs unless otherwise stated. Refunds will exclude original shipping fees paid at checkout.

Warranty Disclaimer

All products are provided "as-is" with no warranties. Warranty issues are handled by the manufacturer.

Safety Guidelines

Always consult the product’s SDS. Products must not be ingested, inhaled, or come into contact with skin or eyes unless specified.

Legal Use Compliance

Products must not be used in violation of any law—local, state, federal, or international.

Accuracy of Orders

Customers are responsible for verifying all order details before submission.

Changes or Cancellations

All changes must be in writing and approved. Cancellations may result in fees for materials, labor, or third-party costs.

Quality System (MD Levels)

Molecular Depot’s MD-Quality System includes:

• MD 1000: Non-regulated use, no change notification
• MD 2000: Non-regulated use, limited change notification
• MD 3000: Regulated use, enhanced quality standards

Delivery & Claims

Orders may ship in parts. Claims for shortages or defects must be submitted within 2 days of receipt. Delivery dates are estimates only.

Extended Payment Terms

Payment is due within 30 days unless agreed otherwise. A 5% weekly penalty applies to late payments. Blue Tiger Scientific reserves discretion on payment application.

Retention of Title

Ownership remains with Blue Tiger Scientific or Molecular Depot LLC until payment is complete. Goods must be stored separately and labeled until paid in full.

Intellectual Property

No rights to manufacturing processes or IP are transferred. Blue Tiger Scientific is not liable for IP-related claims.

Force Majeure

Neither party is liable for delays or failures caused by uncontrollable events (e.g., weather, regulations, supply disruptions).

Manufacturing Access

Product purchase does not grant access to proprietary manufacturing documents or methods.

Resale Prohibition

Products cannot be resold without written approval from Molecular Depot LLC. Blue Tiger Scientific enforces this restriction.

Governing Law

Terms are governed by California and U.S. law. All disputes fall under U.S. jurisdiction.