Product Number: 421-35
CAS Number: 132699-74-2
Molecular Weight: 4640.38
Salt Form: TFA
Purity: >95%
Sequence (3-letter): Glu-Leu-Glu-Pro-Glu-Asp-Glu-Ala-Arg-Pro-Gly-Gly-Phe-Asp-Arg-Leu-Gln-Ser-Glu-Asp-Lys-Ala-Ile-Arg-Thr-Ile-Met-Glu-Phe-Leu-Ala-Phe-Leu-His-Leu-Lys-Glu-Ala-Gly-Ala-Leu-NH2
Sequence (1-letter): ELEPEDEARPGGFDRLQSEDKAIRTIMEFLAFLHLKEAGAL-NH2
Storage: -20 °C or below
Galanin Message Associated Peptide (GMAP) is part of the pre-progalanin Galanin (ppGAL) molecule which is a precursor to the neuropeptide galanin. No physiological role for GMAP was known but recent research suggest it has a role in the innate immune system.