Product Number: 536-10
Growth Hormone Releasing Factor (GHRF, somatocrinin) is a peptide hormone produced in the arcuate nucleus of the hypothalamus. It binds to the GHRH receptor in the anterior pituitary gland and subsequently stimulates growth hormone secretion.
Molecular Weight: 5029.72
Salt Form: TFA
Purity: >96%
Sequence (3-letter): His-Val-Asp-Ala-Ile-Phe-Thr-Thr-Asn-Tyr-Arg-Lys-Leu-Leu-Ser-Gln-Leu-Tyr-Ala-Arg-Lys-Val-Ile-Gln-Asp-Ile-Met-Asn-Lys-Gln-Gly-Glu-Arg-Ile-Gln-Glu-Gln-Arg-Ala-Arg-Leu-Ser-OH
Sequence (1-letter): HVDAIFTTNYRKLLSQLYARKVIQDIMNKQGERIQEQRARLS-OH
Storage: -20 °C or below
Our high quality products are trusted by many scientists and leading companies.