Growth hormone secretion assay

Growth Hormone Releasing Factor, GRF (1-44) amide, human

Product Number: 531-66

Product Details

CAS Number: 83930-13-6

Molecular Weight: 5036.66

Salt Form: TFA

Purity: >95%

Sequence Information

Sequence (3-letter): Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH2

Sequence (1-letter): YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL(NH2)

Storage: -20 °C or below

Description

Growth Hormone Releasing Factor (GRF) (1-44), is a 44-aminoacid peptide hormone released by the hypothalamus and acts on the adenohypophyse to stimulate the secretion of growth hormone.

Additional Information