Heparin Binding Peptide 125720-21-0

Helospectrin II / Helospectin II peptide

Not For Human Use, Lab Use Only.

Cat.#: 314938

Size

• 5.0 mg
• 5.0 mg (TFA removed)
• 20.0 mg
• 20.0 mg (TFA removed)

Buy 1 get 1 free (?) What is TFA?

Special Price 468.00 USD

Availability:4 weeks

Add to Cart

Add to cart to get an online quotation

Product Information

• Product Name Helospectrin II / Helospectin II peptide
• Documents
  • Handling and Storage of Synthetic Peptides
  • Material Safety Data Sheets (MSDS)

Batch to batch variation of the purity

• Sequence Shortening HSDATFTAEYSKLLAKLALQKYLESILGSSTSPRPPS
• Sequence His-Ser-Asp-Ala-Thr-Phe-Thr-Ala-Glu-Tyr-Ser-Lys-Leu-Leu-Ala-Lys-Leu-Ala-Leu-Gln-Lys-Tyr-Leu-Glu-Ser-Ile-Leu-Gly-Ser-Ser-Thr-Ser-Pro-Arg-Pro-Pro-Ser
• Length (aa)37
• Peptide Purity (HPLC)97.6%
• Molecular Formula C 180 H 288 N 46 O 57
• Molecular Weight 4008.4
• CAS No.93585-83-2
• Source Synthetic
• Form Powder
• Description Helospectrin II was found in gila monster (Heloderma suspectum).
• Storage Guidelines Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides
• References
  • Parker DS, Raufman JP, O'donohue TL, Bledsoe M, Yoshida H, Pisano JJ. Amino acid sequences of helospectins, new members of the glucagon superfamily, found in Gila monster venom. J Biol Chem. 1984;259(19):11751-5.

About TFA salt

Trifluoroacetic acid (TFA) is a common counterion from the purification process using High-Performance Liquid Chromatography (HPLC). The presence of TFA can affect the peptide's net weight, appearance, and solubility.

Impact on Net Weight: The TFA salt contributes to the total mass of the product. In most cases, the peptide content constitutes >80% of the total weight, with TFA accounting for the remainder.

Solubility: TFA salts generally enhance the solubility of peptides in aqueous solutions.

In Biological Assays: For most standard in vitro assays, the residual TFA levels do not cause interference. However, for highly sensitive cellular or biochemical studies, please be aware of its presence.

Molar Concentration Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass=Concentration×Volume×Molecular Weight

Dilution Calculator

Concentration (stock) × Volume (stock) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C 1 V 1 = C 2 V 2

Concentration (stock) C1 ×Volume (stock) V1 =Concentration (final) C2 ×Volume (final) V2

Percent Concentration Calculator

This equation is commonly abbreviated as: %(w/v) = Weight of solute(g) / Volume of solution(mL) × 100%

Weight of Solute=Volume of solution×Concentration (%)

Peptide Property

• Analysed Sequence:H-H S D A T F T A E Y S K L L A K L A L Q K Y L E S I L G S S T S P R P P S-OH
• Chemical Formula:C 180 H 288 N 46 O 57
• Sequence length:37
• Extinction coefficient:2560 M-1 cm-1
• GRAVY:-0.31
• Mw average:4008.46
• Theoretical pI:9.42
• Data Source:Peptide Property Calculator

GRAVY = grand average of hydropathy

X: Hydrophobic uncharged residues, like F I L M V W A and P

X: Basic residues, like R K H

X: Acidic residues, like D E

X: Polar uncharged residues, like G S T C N Q and Y

Related Products / Services

• Peptide Services: NovoPro's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.

• Standard Peptide Synthesis: NovoPro offers quality peptides at the most competitive prices in the industry, starting at $3.20 per amino acid. NovoPro provides PepBox – Automatic Quote Tool for online price calculation.

• Peptide Modifications: NovoPro offers a wide range of peptide modification services including isotope labeling (2 H, 15 N, and 13 C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Contact us

+86-21-61941042

86-216-194-1042

admin@frankenthalerfoundation.org

Products

• Peptides
• Antibodies
• Proteins

Featured Services

• Peptide Synthesis
• Gene Synthesis
• RNA synthesis

Support

• About NovoPro
• Citations
• Intellectual Property Promise
• Shipping Rates & Policies
• Return & Refund Policy

TOP

Copyright © 2014 NovoPro Bioscience Inc. All rights reserved. |Terms and Conditions|Privacy Policy| NovoPro products are for RESEARCH USE ONLY.

This website requires cookies, and the limited processing of your personal data in order to function. By using the site you are agreeing to this as outlined in our Privacy Notice and Terms of Use. I agree, dismiss this banner