1. GC31322 [Adomeglivant (LY2409021)] LY2409021 Adomeglivant (LY2409021) is a potent, selective, orally administered, competitive, small-molecule antagonist of the glucagon receptor, with a K i value of 6.66nM.
2. GC25046 [Albiglutide Fragment] Albiglutide fragment is one copy of a 30-amino-acid sequence of modified human GLP-1 (fragment 7-36).
3. GC16232 [BETP] glucagon-like peptide 1 (GLP-1) receptor modulator
4. GC39364 [Cotadutide acetate] MEDI0382 acetate Cotadutide (MEDI0382) acetate is a potent dual agonist of glucagon-like peptide-1 (GLP-1) and GCGR with EC50 values of 6.9 pM and 10.2 pM, respectively.
5. GC11646 [des-His1-[Glu9]-Glucagon (1-29) amide] des-His1-[Glu9]-Glucagon (1-29) amide is a potent and peptide antagonist of the glucagon receptor, with a pA2 of 7.2.
6. GC16482 [Exendin-3 (9-39) amide] Avexitide;Exendin (9-39) Exendin3(9-39) amide is a specific exendin receptor antagonist. Exendin-3 increased cellular cAMP levels and amylase release from dispersed acini from guinea pig pancreas.
7. GC60829 [Exendin-3/4 (59-86)] Exendin-3/4 (59-86) is a Exendin-4 peptide derivative.
8. GC13391 [Exendin-4] Exendin-4 is a 39-amino-acid polypeptide (48-86) and a long-acting glucagon-like peptide-1 (GLP-1) receptor agonist with an IC 50 of 3.22 nM.
9. GC43644 [Exendin-4 (acetate)] Exenatide Acetate Exendin-4 is a potent peptide agonist of the glucagon-like peptide 1 (GLP-1) receptor (Ki = 136 pM).
10. GC34246 [FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS] FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.
11. GC43761 [GLP-1 (1-37) (human, rat, mouse, bovine) (trifluoroacetate salt)] Glucagon-like Peptide-1 GLP-1 (1-37) (human, rat, mouse, bovine) (trifluoroacetate salt) is a full-length precursor form of glucagon-like peptide-1 secreted by the intestine.
12. GC13743 [GLP-1 (9-36) amide] antagonist at the human GLP-1 receptor
13. GC34244 [GLP-1 moiety from Dulaglutide] GLP-1 moiety from Dulaglutide is a 31-amino acid fragment of Dulaglutide which is a glucagon-like peptide 1 receptor (GLP-1) agonist, extracted from patent US 20160369010 A1.
14. GC31363 [GLP-1 receptor agonist 1] LY3502970 GLP-1 receptor agonist 1 (GLP-1 receptor agonist 1) is a GLP-1 receptor agonist extracted from patent WO2018056453A1, Compound 67.
15. GC36147 [GLP-1 receptor agonist 2] GLP-1 receptor agonist 2 is a glucagon-like peptide-1 receptor (GLP-1R) agonist.
16. GC61545 [GLP-1(28-36)amide] GLP-1(28-36)amide, a C-terminal nonapeptide of GLP-1, is a major product derived from the cleavage of GLP-1 by the neutral endopeptidase (NEP).
17. GC61540 [GLP-1(32-36)amide] GLP-1(32-36)amide, a pentapeptide, derived from the C terminus of the glucoregulatory hormone GLP-1.
18. GC33759 [GLP-1(7-36) Acetate (Human GLP-1-(7-36)-amide Acetate)] Glucagon-like peptide-1 (GLP-1)(7-36), amide acetate; Human GLP-1 (7-36), amide acetate GLP-1(7-36) Acetate (Human GLP-1-(7-36)-amide Acetate) is a major intestinal hormone that stimulates glucose-induced insulin secretion from β cells.
19. GC60876 [GLP-1(7-36), amide TFA] Glucagon-like peptide-1 (GLP-1)(7-36), amide TFA; Human GLP-1 (7-36), amide TFA GLP-1(7-36), amide TFA is a major intestinal hormone that stimulates glucose-induced insulin secretion from β cells.
20. GC30058 [GLP-1(7-37)] GLP-1(7-37) is a truncated glucagon-like peptide with an EC 50 value of 0.9 ± 0.1nM for GLP-1 receptors.
21. GC34904 [GLP-1(7-37) acetate] GLP-1(7-37) acetate is an intestinal insulinotropic hormone that augments glucose induced insulin secretion.
22. GC36148 [GLP-1R Antagonist 1] GLP-1R Antagonist 1 (compound 5d) is an orally active, CNS penetrant and non-competitive antagonist of glucagon-like peptide 1 receptor (GLP-1R), with an IC50 of 650 nM.
23. GC13075 [GLP-2 (rat)] intestinal epithelium-specific growth factor
24. GC16646 [GLP-2(1-33) (human)] GLP-2(1-33) (human) is an endocrine hormone that is released from the intestinal L-cell in response to nutrient ingestion.
25. GC60877 [GLP-2(3-33)] GLP-2(3-33), generated naturally by dipeptidylpeptidase IV (DPPIV), acts as a partial agonist on GLP-2 receptor (EC50=5.8 nM).
26. GC15486 [glucagon receptor antagonists 1]
27. GC12569 [glucagon receptor antagonists 2]
28. GC13512 [glucagon receptor antagonists 3]
29. GC19170 [Glucagon receptor antagonists-4] GCGR Antagonist IV Glucagon receptor antagonists-4 is a highly potent, non-peptide and orally active glucagon receptor antagonist.
30. GC36150 [Glucagon-Like Peptide (GLP) I (7-36), amide, human] Glucagon-Like Peptide (GLP) I (7-36), amide, human is a physiological incretin hormone that stimulates insulin secretion.
31. GC36152 [Glucagon-like peptide 1 (1-37), human (TFA)] HuGLP-1 TFA
32. GC31379 [GRA Ex-25] GRA Ex-25 is a potent glucagon receptor inhibitor with IC50 of 56 and 55 nM for rat and human glucagon receptors, respectively.
33. GC34245 [GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS] GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.
34. GC30254 [HAEGTFT] HAEGTFT is the first N-terminal 1-7 residues of GLP-1 peptide.
35. GC31436 [HAEGTFTSD] HAEGTFTSD is a 9-residue peptide of human GLP-1 peptide or GLP-1(7-36), amide.
36. GC31416 [HAEGTFTSDVS] HAEGTFTSDVS is the first N-terminal 1-11 residues of GLP-1 peptide.
37. GC34249 [KQMEEEAVRLFIEWLKNGGPSSGAPPPS]
38. GC17298 [L-168,049] human glucagon receptor (hGR) antagonist
39. GC31343 [LGD-6972] LGD-6972 is a selective and orally active glucagon receptor antagonist.
40. GC10311 [Liraglutide] HAEGTFTSDVSSYL-{N6-[N-(1-oxohexadecyl)-L-γ-Etamyl]-Glu}-GQAAKEFIAWLVRGRG Liraglutide is a highly potent, long-acting GLP-1 receptor agonist (EC50 = 61 pM)and shares 97% of its amino acid sequence identity with human GLP-1 .
41. GC31334 [Lixisenatide] Lixisenatide is a glucagon-like peptide-1 receptor (GLP-1 receptor) agonist that can be used for the treatment of type 2 diabetes.
42. GC10075 [Methylprednisolone Sodium Succinate] glucocorticoid
43. GC14793 [MK 0893] MK 0893 is a potent and selective glucagon receptor (GCGR) antagonist with an IC 50 value of 6.6 nM.
44. GC36753 [NNC-0640] NNC-0640 is a potent human G-protein-coupled glucagon receptor (GCGR) negative allosteric modulator (NAM) with an IC50 of 69.2 nM.
45. GC16969 [Oxyntomodulin] Oxyntomodulin is a 37-amino-acid peptide hormone that simultaneously activates both the glucagon-like peptide-1 receptor and the glucagon receptor, thereby regulating appetite, energy expenditure, and blood glucose levels.
46. GC38832 [PF-06882961]
