Human Growth Hormone Releasing Factor

Growth Hormone Releasing Factor (GRF) (1-40) amide, human

Product Number: 531-67

Product Details

Molecular Weight: 4540.34

Salt Form: TFA

Purity: >95%

Sequence Information

Sequence (3-letter): Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-NH2

Sequence (1-letter): YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGA(NH2)

Storage and Handling

Storage: -20 °C or below

Description

Growth Hormone Releasing Factor (GHRF) is a peptide that stimulates the release of growth hormone via GPCR receptor GHRH-R. N-terminal fragments and modified fragments are used to study the biological roles of GHRF.

Additional Information