Insulin-like growth factor 1 (IGF-1), also called somatomedin C, is a protein that in humans is encoded by the IGF1 gene. IGF-1 is a hormone similar in molecular structure to insulin. It plays an important role in childhood growth and continues to have anabolic effects in adults. A synthetic analog of IGF-1, mecasermin, is used for the treatment of growth failure.
MGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA with polyhistidine tag at the C-terminus
P05019
Escherichia coli
<0.01 EU per 1 μg of the protein by the LAL method.
Measure by its ability to induce MCF-7 cells proliferation. The ED 50 for this effect is 0.9-3.1 ng/mL. The specific activity of recombinant human IGF-I is approximately >1.2 x 10 3 IU/mg.
>95% as determined by SDS-PAGE.
Lyophilized
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 200 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
This product is stable after storage at:
Avoid repeated freeze/thaw cycles.
Blue ice
The price does not include shipping fee and tax.
