Helen Frankenthaler Foundation

Melanocyte-stimulating hormone release inhibitor

Melanocyte Stimulating Hormones (MSH)

Melanocyte Stimulating Hormones (MSH)

Contact Information

  • Email: admin@frankenthalerfoundation.org
  • Email: admin@frankenthalerfoundation.org
  • Phone: +86-21-61941042
  • Fax: 86-216-194-1042
  • CONTACT US

Navigation

  • Home
  • Products
    • Antibodies
      • Epitope Tag Antibodies
      • Loading Control Antibodies
      • Catalog Antibodies
      • Payload Antibodies
    • Catalog Peptides
      • Amyloid peptides
      • Antimicrobial Peptides
      • Neuropeptides
      • RGD Peptides
      • Catalog Peptides
    • Recombinant Proteins
      • Cytokines
      • Immune Checkpoint
      • Biomarker
      • Enzymes & Kinase
      • Catalog Proteins
  • Services
    • Protein Service
      • E.coli Expression System
      • Mammalian Cell Expression
    • Peptide Synthesis
      • Custom peptide Synthesis
      • Glycopeptide Synthesis
      • Peptide Library Service
      • Isotope Labeled Peptides
      • Radiolabeled Peptides
    • Molecular Biology
      • Gene Synthesis
      • Site-Directed Mutagenesis
      • Plasmid DNA Preparation
      • Custom DNA Oligos Modifications
      • RNA Chemical Synthesis
  • Resources & Support
    • FAQs
    • News Highlights
    • Vector Maps
    • Strain Genotypes
    • NovoBuilder
    • Online Tools
  • Company
    • About us
    • Contact

Breadcrumb Navigation

  1. Home
  2. Peptides
  3. Melanocyte Stimulating Hormones (MSH)

Services

  • Gene Synthesis
  • Site-Directed Mutagenesis
  • Plasmid DNA Preparation
  • Protein Crystallography
  • Custom peptide Synthesis
  • E.coli Expression System
  • Peptide Synthesis

Products

  • Primary Antibodies
  • Antimicrobial Peptides
  • Neuropeptides
  • RGD Peptides
  • Cell Penetrating Peptides
  • Catalog Peptides

Shipping & Payment

  • Add the product to the cart to get an Online Quotation
  • FAQ: How to Order?
  • FAQ: How to Pay?
  • FAQ: What's Purchase Order(PO)?
  • FAQ: Shipping Rates & Policies
  • FAQ: Return & Refund Policy

Product List

Product IDProduct NameSequenceFormula
302133beta-Melanocyte-stimulating hormone, β-MSH (monkey)DEGPYRMEHFRWGSPPKDC 98 H 138 N 28 O 29 S
307345γ1-MSH, gamma1-Melanocyte stimulating hormoneYVMGHFRWDRFC 72 H 97 N 21 O 14 S
307756beta-Melanocyte stimulating hormone IDGGPYKMEHFRWGSPPKDC 95 H 134 N 26 O 27 S
308275Melanocyte-stimulating hormone MSH-BVQESADGYRMQHFRWGQPLPC 107 H 157 N 33 O 29 S
309513gamma-Melanocyte stimulating hormoneYVMGHFRWDKFC 72 H 97 N 19 O 14 S
309625beta-Melanocyte stimulating hormoneDSGPYKMEHFRWGSPPKDC 96 H 136 N 26 O 28 S
310273gamma2-Melanocite stimulating hormone, γ2-MSHYVMGHFRWDRFGC 74 H 99 N 21 O 16 S
310328gamma2-Melanocite stimulating hormone-argYVMGHFRWDRFGRC 80 H 111 N 25 O 17 S
313317[Y9]-beta-Melanocyte stimulating hormone [9-18]YFRWGSPPKDC 60 H 81 N 15 O 15
314433β-MSH (human)AEKKDEGPYRMEHFRWGSPPKDC 118 H 174 N 34 O 35 S
316019beta-Melanocyte stimulating hormone / β- MSH, porcineDEGPYKMEHFRWGSPPKDC 98 H 138 N 26 O 29 S
316020γ3-MSHYVMGHFRWDRFGRRNGSSSSGVGGAAQC 126 H 188 N 44 O 37 S
317053Alpha-MSH (oxidized)Ac-SYS-Mox-EHFRWGKPV-NH2C 77 H 109 N 21 O 20 S
317191Melanotropin betaDEGPYKMEHFRWGSPAKDC 96 H 137 N 27 O 28 S

Footer Information

Contact us

+86-21-61941042

86-216-194-1042

admin@frankenthalerfoundation.org

Products
  • Peptides
  • Antibodies
  • Proteins
Featured Services
  • Peptide Synthesis
  • Gene Synthesis
  • RNA synthesis
Support
  • About NovoPro
  • Citations
  • Intellectual Property Promise
  • Shipping Rates & Policies
  • Return & Refund Policy

Copyright © 2014 NovoPro Bioscience Inc. All rights reserved. |Terms and Conditions|Privacy Policy| NovoPro products are for RESEARCH USE ONLY.

This website requires cookies, and the limited processing of your personal data in order to function. By using the site you are agreeing to this as outlined in our Privacy Notice and Terms of Use. I agree, dismiss this banner