Helen Frankenthaler Foundation

Neuropeptide Y analog

Neuropeptide Y (human, rat)

glp 1 7 36 molecular research

Product Information

  • Product Name Neuropeptide Y (human, rat)
  • Documents
  • Sequence Shortening H-YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2
  • Sequence H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Dsp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2
  • Length (aa) 36
  • Peptide Purity (HPLC) 95.5%
  • Molecular Formula C 189 H 285 N 55 O 57 S
  • Molecular Weight 4271.66
  • Source Synthetic
  • Form Powder
  • Description Neuropeptide Y (human, rat) is a widely distributed endogenous neuropeptide which mediates its physiological effects through at least four receptors, Y1, Y2, Y4, and Y5. Neuropeptide Y (human, rat) is one of the most abundant peptides in the central nervous system and is highly conserved throughout evolution. Neuropeptide Y (human, rat) is involved in a range of biochemical processes including appetite control, sexual behaviour and blood pressure regulation.
  • Storage Guidelines Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides
  • References
    • Michel et al (1998) XVI. International Union of Pharmacology recommendations for the nomenclature of neuropeptide Y, peptide YY, and pancreatic polypeptide receptors. Pharmacol.Rev. 50 143 PMID: 9549761
    • Morales-Medina et al (2010) A possible role of neuropeptide Y in depression and stress. Brain Res. 1314 194 PMID: 19782662
    • Holzer et al (2012) Neuropeptide Y, peptide YY and pancreatic polypeptide in the gut-brain axis. Neuropeptides 2012 46(6) 261 PMID: 22979996

About TFA salt

Trifluoroacetic acid (TFA) is a common counterion from the purification process using High-Performance Liquid Chromatography (HPLC). The presence of TFA can affect the peptide's net weight, appearance, and solubility.

Impact on Net Weight:

The TFA salt contributes to the total mass of the product. In most cases, the peptide content constitutes >80% of the total weight, with TFA accounting for the remainder.

Solubility:

TFA salts generally enhance the solubility of peptides in aqueous solutions.

In Biological Assays:

For most standard in vitro assays, the residual TFA levels do not cause interference. However, for highly sensitive cellular or biochemical studies, please be aware of its presence.

Molar Concentration Calculator

Dilution Calculator

Percent Concentration Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

  • Peptide Services: NovoPro's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.
  • Standard Peptide Synthesis: NovoPro offers quality peptides at the most competitive prices in the industry, starting at $3.20 per amino acid. NovoPro provides PepBox – Automatic Quote Tool for online price calculation.
  • Peptide Modifications: NovoPro offers a wide range of peptide modification services including isotope labeling (2 H, 15 N, and 13 C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.