Neurotensin (8-13) N-Acetyl supplier NTS1 and NTS2 agonist

function

Neuromedin-U-25

Ligand for receptors NMUR1 and NMUR2 (By similarity).

Stimulates muscle contractions of specific regions of the gastrointestinal tract. In humans, NmU stimulates contractions of the ileum and urinary bladder

Neuromedin precursor-related peptide 33

Does not function as a ligand for either NMUR1 or NMUR2. Indirectly induces prolactin release although its potency is much lower than that of neuromedin precursor-related peptide 36.

Neuromedin precursor-related peptide 36

Does not function as a ligand for either NMUR1 or NMUR2. Indirectly induces prolactin release from lactotroph cells in the pituitary gland, probably via the hypothalamic dopaminergic system.

Gene Ontology

Gene Ontology (GO) annotations organized by slimming set.

Access the complete set of GO annotations on QuickGO

• • P486455 GO annotations based on evolutionary models

Keywords

• Molecular function

Enzyme and pathway databases

• • R-HSA-375276Peptide ligand-binding receptors
  • R-HSA-416476G alpha (q) signalling events
  • R-HSA-418594G alpha (i) signalling events

Protein names

• Recommended name

Neuromedin-U

• • Neuromedin precursor-related peptide 36 (NURP36)
  • Neuromedin precursor-related peptide 33 (NURP33)
  • Neuromedin-U-25 (NmU-25)

Gene names

• • Name

NMU

Organism names

• Taxonomic identifier
• Organism
• Taxonomic lineage

Eukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo

Accessions

• Primary accession

P48645

Proteomes

• • Identifier
  • Component

Chromosome 4

Organism-specific databases

Keywords

• Cellular component

Features

Showing features for natural variant.

Organism-specific databases

Miscellaneous

Genetic variation databases

Tissue specificity

Expressed throughout the enteric nervous system with highest levels being found in the jejunum.

Gene expression databases

• • ENSG00000109255Expressed in tongue squamous epithelium and 141 other cell types or tissues

• • P48645baseline and differential

Organism-specific databases

• • ENSG00000109255Tissue enhanced (esophagus, skin, vagina)

Binary interactions

Protein-protein interaction databases

• • 116082122 interactors

• • P48645372 interactors

• • P4864587 interactors

Miscellaneous

• • P48645protein

Sequence similarities

Belongs to the NmU family.

Keywords

• Domain

Family and domain databases

View the Phylogenomic databases for this entry within the Similar Proteins section.

View all family and domain features for this entry's canonical sequence in the UniParc Feature Viewer.

• • PTHR15390NEUROMEDIN-U 1 hit
  • PTHR15390:SF0NEUROMEDIN-U 1 hit

• Sequence status

Complete

• Sequence processing

The displayed sequence is further processed into a mature form.

• Length

174

• Mass (Da)

19,741

• Last updated

1996-02-01 v1

• MD5 Checksum

7C04FA5F90267AD8C01C28FE4C14F174

MLRTESCRPRSPAGQVAAASPLLLLLLLLAWCAGACRGAPILPQGLQPEQQLQLWNEIDDTCSSFLSIDSQPQASNALEELCFMIMGMLPKPQEQDEKDNTKRFLFHYSKTQKLGKSNVVSSVVHPLLQLVPHLHERRMKRFRVDEEFQSPFASQSRGYFLFRPRNGRRSAGFI

Computationally mapped potential isoform sequences

There are 3 potential isoforms mapped to this entry

Keywords

• Technical term

Sequence databases

• • I38063I38063

Genome annotation databases

UniRef clusters

Orthologs & paralogs

Phylogenomic databases

• • P486455 GO annotations based on evolutionary models

Organism-specific databases

Disclaimer

Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. Our staff consists of biologists and biochemists that are not trained to give medical advice.