H-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH₂
Product Number: 4027697
CAS Number: 161748-29-4
Price range: $ 451.33 through $ 1,782.77
Pack size available:
Glucagon-like peptide-1 (GLP-1) is efficiently degraded by the enzyme dipeptidyl peptidase IV (DPP IV), yielding the major metabolite GLP-1 (9-36) amide. GLP-1 (9-36) amide does not affect glucose disposal in mice either in the presence or absence of intact GLP-1 receptors or in the presence or absence of stimulated insulin levels. This suggests that the GLP-1 metabolite is not involved in the regulation of glucose homeostasis. Elahi et al. have shown that this GLP-1 metabolite acts as a weak insulinotropic agent and inhibits hepatic glucose production.
Salt form: Trifluoroacetate
Molecular weight: 3089.46
Chemical Formula: C₁₄₀H₂₁₄N₃₆O₄₃
Storage Temperature: < -15°C
Synonyms: Preproglucagon (100-127) amide (human, bovine, guinea pig, mouse, porcine, rat)
One Letter code: EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH₂
Source: Synthetic
Old Product Number: H-4012
Argentina, Australia, Austria, Belgium, Brazil, Bulgaria, Canada, Chile, China, Colombia, Croatia, Cyprus, Czech Republic, Denmark, Ecuador, Egypt, Estonia, Finland, France, Germany, Greece, Guadeloupe, Hong Kong, Iceland, India, Indonesia, Iran, Iraq, Ireland, Israel, Italy, Japan, Jordan, Kenya, Kuwait, Latvia, Lebanon, Liechtenstein, Lithuania, Luxembourg, Macao, Malaysia, Mauritius, Mexico, Montenegro, Netherlands, New Zealand, Nigeria, Norway, Pakistan, Papua New Guinea, Peru, Philippines, Poland, Portugal, Puerto Rico, Romania, Russia, Serbia, Singapore, Slovakia, Slovenia, South Africa, South Korea, Spain, Sweden, Switzerland, Taiwan, Thailand, Türkiye, United Arab Emirates, United Kingdom (UK), United States (US), Uruguay, Other countries.
