ProANP fragment for rodent models

PACAP (1-38), human, ovine, rat

PACAP (1-38), human, ovine, rat - GenScript

Product Information

This peptide is a 38-amino acid form of Pituitary Adenylate Cyclase-Activating Polypeptide (PACAP) that is identical in human, ovine, and rat species.

Key Details

• Sequence: HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK
• Molecular Formula: C₁₈₃H₂₉₅N₅₅O₅₃S
• Molecular Weight: 4541.2 Da
• Purity: Typically >95% by HPLC

Applications

PACAP (1-38) is a potent neuropeptide with a wide range of biological functions.

• Neuroscience Research
• Endocrinology Studies
• Cell Signaling and cAMP Activation
• Vasodilation and Cardiovascular Research

Storage and Handling

For long-term storage, lyophilized powder should be kept at -20°C. Reconstitute in sterile water or buffer immediately before use.

Reconstitution Guidelines

• Use appropriate sterile solvent.
• Aliquot to avoid repeated freeze-thaw cycles.
• Store reconstituted peptide at -20°C or below for short-term use.

Ordering Information

Note

This product is for research use only. Not for diagnostic or therapeutic use in humans or animals.