Product Number: 471-85
CAS Number: 93755-85-2
Molecular Weight: 2857.52
Salt Form: TFA
Purity: >96%
Sequence (3-letter): Val-Pro-Leu-Pro-Ala-Gly-Gly-Gly-Thr-Val-Leu-Thr-Lys-Met-Tyr-Pro-Arg-Gly-Asn-His-Trp-Ala-Val-Gly-His-Leu-Met-NH2
Sequence (1-letter): VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2
Storage: -20 °C or below
Gastrin Releasing Peptide, human, is a ligand for the GRP receptor and is expressed in a subtype of peptidergic dorsal root ganglion neurons. GRP stimulates pepsinogen release and has also been identified as a tumor marker in the diagnosis of small-cell lung carcinoma. GRP is the mammalian analog of Bombesin.
Our high quality products are trusted by many scientists and leading companies.