Sheep growth hormone releasing factor

Growth Hormone Releasing Factor, GRF (1-44) amide, human bovine - Echelon Biosciences

testosterone enanthate cas no 315 37 7 molecular research

Growth Hormone Releasing Factor, GRF (1-44) amide, human bovine

Product Number: 535-15

Product Details

CAS Number: 88894-91-1

Molecular Weight: 5107.86

Salt Form: TFA

Purity: >96%

Sequence Information

Sequence (3-letter): Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Asn-Arg-Gln-Gln-Gly-Glu-Arg-Asn-Gln-Glu-Gln-Gly-Ala-Lys-Val-Arg-Leu-NH2

Sequence (1-letter): YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2

Storage: -20 °C or below

Description

Growth Hormone Releasing Factor (GRF or GHRF), is released by the hypothalamus to stimulate the secretion of growth hormone. The bovine form shares ~90% identity with human GRF.

Additional Information