Product Number: 535-15
CAS Number: 88894-91-1
Molecular Weight: 5107.86
Salt Form: TFA
Purity: >96%
Sequence (3-letter): Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Asn-Arg-Gln-Gln-Gly-Glu-Arg-Asn-Gln-Glu-Gln-Gly-Ala-Lys-Val-Arg-Leu-NH2
Sequence (1-letter): YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2
Storage: -20 °C or below
Growth Hormone Releasing Factor (GRF or GHRF), is released by the hypothalamus to stimulate the secretion of growth hormone. The bovine form shares ~90% identity with human GRF.
Our high quality products are trusted by many scientists and leading companies.