UniProtKB
Advanced | List
Search
Entry
Variant viewer
Feature viewer
Genomic coordinates
Publications
External links
History
Tools
Download AddAdd a publicationEntry feedback
Alpha-conotoxins act on postsynaptic membranes, they bind to the nicotinic acetylcholine receptors (nAChR) and thus inhibit them. This toxin inhibits both adult and fetal (alpha-1/beta-1/epsilon/delta and alpha-1/beta-1/gamma/delta subunits) mammalian muscle nicotinic acetylcholine receptors (nAChR). In vivo, it causes paralysis and death in mice and fish.1 publication
GO annotations
GO-CAM models New
Gene Ontology (GO) annotations organized by slimming set.
Access the complete set of GO annotations on QuickGO
UniProt Annotation
GO Annotation
Secreted1 publication
Complete GO annotation on QuickGO
Expressed by the venom duct.1 publication
The cysteine framework is C-C.Curated
See also sequence in UniParc or sequence clusters in UniRef
MQTAYWVMVMMMVMWITAPLSEGGKPKLIIRGLVPNDLTPQRILRSLISGRTYGIYDAKPPFSCAGLRGGCVLPPNLRPKFKEGR
Molecular mass is 3,540.7 Da. Determined by MALDI. 1 publication
Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. Our staff consists of biologists and biochemists that are not trained to give medical advice.
Release 2026_01 | Statistics
© 2002 – 2026 UniProt consortium
License & Disclaimer | Privacy Notice
Get in touch
UniProt is an ELIXIR core data resourceUniProt is a GBC global core biodata resource
Main funding by:National Institutes of Health
This website requires cookies, and the limited processing of your personal data in order to function. By using the site you are agreeing to this as outlined in our Privacy Notice.I agree, dismiss this banner
Help⬆