Helen Frankenthaler Foundation

α-Conotoxin IMI supplier

UniProt Entry for Alpha-conotoxin PrXA

Alpha-conotoxin PrXA - Conus parius (Cone snail) | UniProtKB | UniProt

UniProtKB

  • BLAST
  • Align
  • Peptide search
  • ID mapping
  • SPARQL

Advanced | List

Search

  • Function
  • Names & Taxonomy
  • Subcellular Location
  • Phenotypes & Variants
  • PTM/Processing
  • Expression
  • Interaction
  • Structure
  • Family & Domains
  • Sequence
  • Similar Proteins

P0C8S5 · CCAA_CONPI

  • Protein Alpha-conotoxin PrXA
  • Status UniProtKB reviewed (Swiss-Prot)
  • Organism Conus parius (Cone snail)
  • Amino acids 85 (go to sequence)
  • Protein existence Evidence at protein level
  • Annotation score 4/5

Entry

Variant viewer

Feature viewer

Genomic coordinates

Publications

External links

History

Tools

Download AddAdd a publicationEntry feedback

Function

function

Alpha-conotoxins act on postsynaptic membranes, they bind to the nicotinic acetylcholine receptors (nAChR) and thus inhibit them. This toxin inhibits both adult and fetal (alpha-1/beta-1/epsilon/delta and alpha-1/beta-1/gamma/delta subunits) mammalian muscle nicotinic acetylcholine receptors (nAChR). In vivo, it causes paralysis and death in mice and fish.1 publication

Gene Ontology

GO annotations

GO-CAM models New

Gene Ontology (GO) annotations organized by slimming set.

AspectTerm
Molecular Functionacetylcholine receptor inhibitor activitySource:UniProtKB-KW
Molecular Functionion channel regulator activitySource:UniProtKB-KW
Molecular Functiontoxin activitySource:UniProtKB-KW

Access the complete set of GO annotations on QuickGO

Keywords
  • Molecular function
    • #Acetylcholine receptor inhibiting toxin
    • #Ion channel impairing toxin
    • #Neurotoxin
    • #Postsynaptic neurotoxin
    • #Toxin
Protein family/group databases
  • TCDB
    • 8.B.36.1.2the contulakin lt (contulakin lt) family

Names & Taxonomy

Protein names
  • Recommended name Alpha-conotoxin PrXA Curated
  • Short name Alpha-C-PrXA 1 publication
Organism names
  • Taxonomic identifier 505247(NCBI)
  • Organism Conus parius (Cone snail)
  • Taxonomic lineage cellular organisms>Eukaryota (eukaryotes)>Opisthokonta>Metazoa (animals)>Eumetazoa>Bilateria>Protostomia>Spiralia>Lophotrochozoa>Mollusca (molluscs)>Gastropoda (gastropods)>Caenogastropoda>Neogastropoda>Conoidea>Conidae (Cone snails)>Conus>Phasmoconus
Accessions
  • Primary accession P0C8S5
  • Secondary accessions
    • E2DEK9
Organism-specific databases
  • ConoServer
    • 2859PrXA

Subcellular Location

UniProt Annotation

GO Annotation

Secreted1 publication

  • extracellular regionSource:UniProtKB-SubCell
  • host cell postsynaptic membraneSource:UniProtKB-KW

Complete GO annotation on QuickGO

Keywords
  • Cellular component
    • #Secreted

Expression

Tissue specificity

Expressed by the venom duct.1 publication

Structure

3D structure databases
  • AlphaFoldDB
    • P0C8S5
  • ModBase
    • Search…
  • SWISS-MODEL-Workspace
    • Submit a new modelling project…

Family & Domains

Domain

The cysteine framework is C-C.Curated

Keywords
  • Domain
    • #Signal
Family and domain databases
  • MobiDB
    • Search…

Sequence

  • Sequence status Complete
  • Sequence processing The displayed sequence is further processed into a mature form.

See also sequence in UniParc or sequence clusters in UniRef

  • Length 85
  • Mass (Da) 9,492
  • Last updated 2018-05-23 v2
  • MD5 Checksum 5BA5E95DA3A213882218F5A4B0E9E7AA

MQTAYWVMVMMMVMWITAPLSEGGKPKLIIRGLVPNDLTPQRILRSLISGRTYGIYDAKPPFSCAGLRGGCVLPPNLRPKFKEGR

Mass Spectrometry

Molecular mass is 3,540.7 Da. Determined by MALDI. 1 publication

Keywords
  • Technical term
    • #Direct protein sequencing
Sequence databases
Nucleotide SequenceProtein SequenceMolecule TypeStatus
GQ981401 EMBL· GenBank· DDBJADN79120.1 EMBL· GenBank· DDBJmRNA

Similar Proteins

UniRef clusters
Orthologs & paralogs

Disclaimer

Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. Our staff consists of biologists and biochemists that are not trained to give medical advice.

Release 2026_01 | Statistics

© 2002 – 2026 UniProt consortium

License & Disclaimer | Privacy Notice

  • Core data
    • Proteins (UniProtKB)
    • Species (Proteomes)
    • Protein clusters (UniRef)
    • Sequence archive (UniParc)
  • Supporting data
    • Literature citations
    • Taxonomy
    • Keywords
    • Subcellular locations
    • Cross-referenced databases
    • Diseases
  • Tools
    • BLAST
    • Align
    • Retrieve/ID mapping
    • Peptide search
    • Tool results
  • Information
    • Cite UniProt
    • About&Help
    • UniProtKB manual
    • Technical corner
    • Expert biocuration
    • Statistics

Get in touch

UniProt is an ELIXIR core data resourceUniProt is a GBC global core biodata resource

Main funding by:National Institutes of Health

This website requires cookies, and the limited processing of your personal data in order to function. By using the site you are agreeing to this as outlined in our Privacy Notice.I agree, dismiss this banner

Help⬆