Helen Frankenthaler Foundation

Gastric Inhibitory Polypeptide (6-30) amide human product

Gastric Inhibitory Polypeptide (1-30) amide (porcine) -HongTide Biotechnology

Gastric Inhibitory Polypeptide (1-30) amide (porcine)

H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-NH2

Purity: >95%HPLC

Storage Conditions: -20°C

We can provide this product with other purity from crude to 98%, please contact us for more information. For reserach use only and not for human use!

Product details

Cat#:147P05
Sequence:H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-NH2
Sequence(single):YAEGTFISDYSIAMDKIRQQDFVNWLLAQK-NH2
Synonyms:GIP (1-30) amide (porcine), Glucose-Dependent Insulinotropic Polypeptide (1-30) amide (porcine), Gastric Inhibitory Peptide (1-30), amide, porcine
Molecular Formula:C162H245N41O47S
Molecular Weight:3551.04
CAS#:134846-93-8
Source:Synthetic
Storage Conditions:-20°C, avoid light, cool and dry place
Areas of Interest:Diabetes
Descriptions:

Gastric Inhibitory Polypeptide (1-30) amide (porcine) also called GIP (1-30) amide (porcine), Glucose-Dependent Insulinotropic Polypeptide (1-30) amide (porcine), Gastric Inhibitory Peptide (1-30), amide, porcine, is a full glucose-dependent insulinotropic polypeptide (GIP) receptor agonist with high affinity equal to native GIP(1-42). GIP (1-30) amide (porcine) is a weak inhibitor of gastric acid secretion and potent stimulator of insulin.

Appearance:

White Lyophilisate

References

1.Feedback regulation of glucose-dependent insulinotropic polypeptide (GIP) secretion by insulin in conscious rats. M.Bryer-Ash et al., Regul. Pept., 51, 101 (1994)

How to place a order:

  • Contact us at: +86-(0)-15825357791 or admin@frankenthalerfoundation.org;
  • Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
  • Place us a purchaser order, we can send you a sales contract too if you need;
  • Start synthesis, and we will inform you the updates of synthesis in time;
  • Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
  • Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them;
  • After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.